PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619876.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 246aa    MW: 28282.3 Da    PI: 9.6909
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619876.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd  lv +++++G ++W + +++ g++R++k+c++rw++yl
   XP_013619876.1 14 RGEWTAEEDRMLVAYINKYGVRDWGALPKRAGLHRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding54.82.1e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g++T++E++ +++ + +lG++ W++Ia+ m+ +Rt++++k++w++ 
   XP_013619876.1  67 KGKFTPQEEDDIIKFHSLLGNR-WAAIAKQMP-NRTDNDIKNHWNSC 111
                      79********************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.184961IPR017930Myb domain
SuperFamilySSF466893.28E-3011108IPR009057Homeodomain-like
SMARTSM007179.2E-161363IPR001005SANT/Myb domain
PfamPF002491.1E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-231568IPR009057Homeodomain-like
CDDcd001677.46E-111661No hitNo description
PROSITE profilePS5129425.57362116IPR017930Myb domain
SMARTSM007171.4E-1566114IPR001005SANT/Myb domain
PfamPF002492.0E-1667111IPR001005SANT/Myb domain
CDDcd001671.42E-969109No hitNo description
Gene3DG3DSA:1.10.10.602.8E-2569116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MGRTTWFDVD GIKRGEWTAE EDRMLVAYIN KYGVRDWGAL PKRAGLHRCG KSCRLRWLNY  60
LKPGIKKGKF TPQEEDDIIK FHSLLGNRWA AIAKQMPNRT DNDIKNHWNS CLKKRLRRSG  120
IDPMTHEPIK ATSSSTRSSP AQRHSSSTTS FSLSSTGSVR LLNKLAAGIS SRKLALDRIR  180
TVMISSEPRE VDEEEKMMIS SRKEEEKVIG CFMEIDKNLI TTMSLDELAC DSSYYYYDDW  240
LRGCFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619876.10.0PREDICTED: transcription factor MYB34-like
SwissprotO643991e-56MYB34_ARATH; Transcription factor MYB34
TrEMBLA0A078HV830.0A0A078HV83_BRANA; BnaC02g22880D protein
TrEMBLA0A0D3AQH40.0A0A0D3AQH4_BRAOL; Uncharacterized protein
STRINGBra008149.1-P1e-169(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74430.11e-109myb domain protein 95